PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008221733.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 483aa    MW: 53685.9 Da    PI: 7.2483
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008221733.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1683.1e-52191491128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     + pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t +g+Wkatg+d++++s+
  XP_008221733.1  19 MLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIKQLDIYKFDPWDLPKLAASGEKEWYFYCPRDRKYRNSTRPNRVTGAGFWKATGTDRPIYSS 112
                     579***************************.89***************8888899***************************************9 PP

             NAM  96 ....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ +glkk+Lvfykgra kg+ktdW+mhe+rl
  XP_008221733.1 113 egacSSKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 149
                     77776777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-5717183IPR003441NAC domain
PROSITE profilePS5100556.1119183IPR003441NAC domain
PfamPF023652.4E-2521149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MDERSDMNII GGDKMDEVML PGFRFHPTDE ELVGFYLKRK IQQRPLSIEL IKQLDIYKFD  60
PWDLPKLAAS GEKEWYFYCP RDRKYRNSTR PNRVTGAGFW KATGTDRPIY SSEGACSSKC  120
IGLKKSLVFY KGRAAKGVKT DWMMHEFRLP SLTDSLPPKR SSSFMDKTIP ANDSWAICRI  180
FKKTNSSHAH QRALSHHSWV SVLPETNTYD DHMLGSKAAH SATHHHHQHE FSSERMPLTS  240
KTNSTTNFCG NNNNDIQISS TTSSMSPLDI YTNSSYKPVN PLMMGCNIKL PYQYFPISNS  300
NGDYFSSTPS FTFSSSPLET PSGPVAKCTV DVSSLLLNMS SSMLGDYNGS NSINKASAES  360
TNFEFSTNTG SQDQCNGGFS SMTLPHHHEV MQGNNNMGNG HDTVVGLIKN NISNVNSDVT  420
EDADDQRWET SVRSNTGVPL MMSNSFPLPL NIGGGGGGDA WKSSLTWESS PCPSEMSTTR  480
CYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-5451882170NAC domain-containing protein 19
4dul_A2e-5451882170NAC domain-containing protein 19
1ut7_B2e-5451882170NO APICAL MERISTEM PROTEIN
1ut7_A2e-5451882170NO APICAL MERISTEM PROTEIN
1ut4_B2e-5451882170NO APICAL MERISTEM PROTEIN
1ut4_A2e-5451882170NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008221733.10.0PREDICTED: protein FEZ
SwissprotQ9ZVH01e-103FEZ_ARATH; Protein FEZ
TrEMBLM5Y2Y70.0M5Y2Y7_PRUPE; Uncharacterized protein
STRINGVIT_01s0026g02360.t011e-154(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-100NAC family protein